A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	11323
Swiss-prot Accession number	P01258 (Sequence in FASTA format)
Description	Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	141 Amino acids
Molecular weight	15467
References	1  PubMed abstract 6546550 2  PubMed abstract 3872459 3  PubMed abstract 3485540 4  PubMed abstract 3034287 5  PubMed abstract 2571128 6  PubMed abstract 1761559 7   Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8  PubMed abstract 15489334 9  PubMed abstract 2408883 10  PubMed abstract 6148938 11  PubMed abstract 5760861 12  PubMed abstract 2001366 13  PubMed abstract 6132180 14  PubMed abstract 14759258
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (85-116)
Receptor	P30988    Detail in HMRbase
Gene ID	796
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	11324
Swiss-prot Accession number	P01258 (Sequence in FASTA format)
Description	Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Katacalcin is a potent plasma calcium-lowering peptide
Protein Length	141 Amino acids
Molecular weight	15467
References	1  PubMed abstract 6546550 2  PubMed abstract 3872459 3  PubMed abstract 3485540 4  PubMed abstract 3034287 5  PubMed abstract 2571128 6  PubMed abstract 1761559 7   Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8  PubMed abstract 15489334 9  PubMed abstract 2408883 10  PubMed abstract 6148938 11  PubMed abstract 5760861 12  PubMed abstract 2001366 13  PubMed abstract 6132180 14  PubMed abstract 14759258
Domain Name	Calc_CGRP_IAPP
Hormone Name	Katacalcin
Mature Hormone Sequence	DMSSDLERDHRPHVSMPQNAN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (121-141)
Receptor	P30988    Detail in HMRbase
Gene ID	796
PDB ID	N/A
Drugpedia	wiki
Comments