![]() |
|
|
|
|
|
|
HMRbase accession number | 11313 |
Swiss-prot Accession number | P01232 (Sequence in FASTA format) |
Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Protein Length | 141 Amino acids |
Molecular weight | 14889 |
References | 1 PubMed abstract 2744222 2 PubMed abstract 1701088 3 Lv X., Gao R., Liu S., Li J.; "The sequence and expression of Meishan porcine LH-beta gene."; Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4 PubMed abstract 4770795 |
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | SRGPLRPLCRPINATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELSFASIRLPGCPPGVDPTVSFPVALSCHCGPCRLSSSDCGGPRAQPLACDRPLLPGLLFL |
Position of mature hormone in Pre-Hormone protein | 121 Residues from position (21-141) |
Receptor | P16582
Detail in HMRbase |
Gene ID | 397153 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |