![]() |
|
|
|
|
|
|
HMRbase accession number | 11311 |
Swiss-prot Accession number | P01229 (Sequence in FASTA format) |
Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Protein Length | 141 Amino acids |
Molecular weight | 15345 |
References | 1 PubMed abstract 6690982 2 PubMed abstract 1191677 3 PubMed abstract 4685398 4 PubMed abstract 4719207 5 PubMed abstract 1991473 6 PubMed abstract 1495492 7 PubMed abstract 1727547 8 PubMed abstract 9457942 9 PubMed abstract 9886510 10 PubMed abstract 11870227 |
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL |
Position of mature hormone in Pre-Hormone protein | 121 Residues from position (21-141) |
Receptor | P22888
Detail in HMRbase |
Gene ID | 3972 |
PDB ID | 1M92 |
Drugpedia | wiki |
Comments |