A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11308 |
| Swiss-prot Accession number | P01225 (Sequence in FASTA format) |
| Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Protein Length | 129 Amino acids |
| Molecular weight | 14700 |
| References | 1 PubMed abstract 2885163 2 PubMed abstract 2494176 3 PubMed abstract 3139991 4 PubMed abstract 16554811 5 PubMed abstract 15489334 6 PubMed abstract 3151250 7 PubMed abstract 1249074 8 PubMed abstract 4835136 9 PubMed abstract 6774759 10 PubMed abstract 11501762 11 PubMed abstract 11222739 12 PubMed abstract 15662415 13 PubMed abstract 10391209 14 Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N.,Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L.,Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q.,Lander E.S.; Nat. Genet. 23:373-373(1999). 15 PubMed abstract 2885163 16 PubMed abstract 2494176 17 PubMed abstract 3139991 18 PubMed abstract 16554811 19 PubMed abstract 15489334 20 PubMed abstract 3151250 21 PubMed abstract 1249074 22 PubMed abstract 4835136 23 PubMed abstract 6774759 24 PubMed abstract 11501762 25 PubMed abstract 11222739 26 PubMed abstract 15662415 27 PubMed abstract 8220432 28 Layman L.C., Lee E.-J., Peak D.B., Namnoum A.B., Vu K.V.,van Lingen B.L., Gray M.R., McDonough P.G., Reindollar R.H.,Jameson J.L.; "Delayed puberty and hypogonadism caused by mutations in the follicle-stimulating hormone beta-subunit gene."; N. Engl. J. Med. 337:607-611(1997). 29 PubMed abstract 9280841 30 PubMed abstract 10391209 31 Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N.,Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L.,Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q.,Lander E.S.; Nat. Genet. 23:373-373(1999). |
| Domain Name | Cys_knot |
| Hormone Name | Follicle-stimulating hormone beta subunit |
| Mature Hormone Sequence | NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
| Position of mature hormone in Pre-Hormone protein | 111 Residues from position (19-129) |
| Receptor | P23945
Detail in HMRbase |
| Gene ID | 2488 |
| PDB ID | 1FL7 1XWD |
| Drugpedia | wiki |
| Comments |