![]() |
|
|
|
|
|
|
HMRbase accession number | 11306 |
Swiss-prot Accession number | P01223 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15624 |
References | 1 PubMed abstract 6325416 2 PubMed abstract 5101174 3 PubMed abstract 5101173 4 PubMed abstract 8670056 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYMMHVERKECAYCLTINTTVCAGYCMTRDVNGKLFLPKYALSQDVCTYRDFMYKTAEIPGCPRHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | Q27987
Detail in HMRbase |
Gene ID | 281552 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |