A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10028 |
Swiss-prot Accession number | P01197 (Sequence in FASTA format) |
Description | Corticotropin (Adrenocorticotropic hormone) (ACTH) [Contains:Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP)]. |
Source organism | Squalus acanthias (Spiny dogfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | ACTH stimulates the adrenal glands to release cortisol |
Protein Length | 39 Amino acids |
Molecular weight | 4686 |
References | 1 PubMed abstract 4375977 2 PubMed abstract 5476715 3 PubMed abstract 4375978 4 PubMed abstract 4375977 5 PubMed abstract 5476715 6 PubMed abstract 4375978 |
Domain Name | ACTH_domain |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPMGRKRRPIKVYPNSFEDESVENMGPEL |
Position of mature hormone in Pre-Hormone protein | 1 Residues from position (1-39) |
Receptor | Q6Q488
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11290 |
Swiss-prot Accession number | P01197 (Sequence in FASTA format) |
Description | Corticotropin (Adrenocorticotropic hormone) (ACTH) [Contains:Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP)]. |
Source organism | Squalus acanthias (Spiny dogfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
Protein Length | 39 Amino acids |
Molecular weight | 4686 |
References | 1 PubMed abstract 4375977 2 PubMed abstract 5476715 3 PubMed abstract 4375978 4 PubMed abstract 4375977 5 PubMed abstract 5476715 6 PubMed abstract 4375978 |
Domain Name | ACTH_domain |
Hormone Name | Melanotropin alpha (Alpha-MSH) |
Mature Hormone Sequence | SYSMEHFRWGKPM |
Position of mature hormone in Pre-Hormone protein | 1 Residues from position (1-13) |
Receptor | Q6Q488
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |