![]() |
|
|
|
|
|
|
HMRbase accession number | 11274 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Melanotropin gamma (Gamma-MSH) |
Mature Hormone Sequence | YVMGHFRWDRF |
Position of mature hormone in Pre-Hormone protein | 11 Residues from position (77-87) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11275 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | ACTH stimulates the adrenal glands to release cortisol |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (136-174) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11276 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Melanotropin alpha (Alpha-MSH) |
Mature Hormone Sequence | SYSMEHFRWGKPV |
Position of mature hormone in Pre-Hormone protein | 13 Residues from position (136-148) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11277 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Lipotropin beta (Beta-LPH) |
Mature Hormone Sequence | ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 91 Residues from position (177-267) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11278 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Lipotropin gamma (Gamma-LPH) |
Mature Hormone Sequence | ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKD |
Position of mature hormone in Pre-Hormone protein | 58 Residues from position (177-234) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11279 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Melanotropin beta (Beta-MSH) |
Mature Hormone Sequence | DEGPYKMEHFRWGSPPKD |
Position of mature hormone in Pre-Hormone protein | 18 Residues from position (217-234) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11280 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (237-267) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11281 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Met-enkephalin is an endogenous opiate |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Met-enkephalin |
Mature Hormone Sequence | YGGFM |
Position of mature hormone in Pre-Hormone protein | 5 Residues from position (237-241) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |