![]() |
|
|
|
|
|
|
HMRbase accession number | 11242 |
Swiss-prot Accession number | P01143 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 187 Amino acids |
Molecular weight | 20680 |
References | 1 PubMed abstract 3876950 2 PubMed abstract 3274895 3 PubMed abstract 6603620 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (145-185) |
Receptor | P35353 Detail in HMRbase P47866 Detail in HMRbase |
Gene ID | 81648 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |