A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11228 |
Swiss-prot Accession number | O42143 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 266 Amino acids |
Molecular weight | 30951 |
References | 1 PubMed abstract 9223287 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (53-81) |
Receptor | Q8UVY5
Detail in HMRbase |
Gene ID | 373686 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11229 |
Swiss-prot Accession number | O42143 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 266 Amino acids |
Molecular weight | 30951 |
References | 1 PubMed abstract 9223287 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 1A |
Mature Hormone Sequence | HAEGTFTSDVTQQLDEKAAKEFIDWLINGGPSKEIIS |
Position of mature hormone in Pre-Hormone protein | 37 Residues from position (97-133) |
Receptor | Q8UVY5
Detail in HMRbase |
Gene ID | 373686 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11230 |
Swiss-prot Accession number | O42143 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 266 Amino acids |
Molecular weight | 30951 |
References | 1 PubMed abstract 9223287 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 1B |
Mature Hormone Sequence | HAEGTYTNDVTEYLEEKAAKEFIEWLIKGKP |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (142-172) |
Receptor | Q8UVY5
Detail in HMRbase |
Gene ID | 373686 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11231 |
Swiss-prot Accession number | O42143 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 266 Amino acids |
Molecular weight | 30951 |
References | 1 PubMed abstract 9223287 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 1C |
Mature Hormone Sequence | HAEGTFTNDMTNYLEEKAAKEFVGWLIKGRP |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (180-210) |
Receptor | Q8UVY5
Detail in HMRbase |
Gene ID | 373686 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11232 |
Swiss-prot Accession number | O42143 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 266 Amino acids |
Molecular weight | 30951 |
References | 1 PubMed abstract 9223287 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2 |
Mature Hormone Sequence | HADGSFTNDINKVLDIIAAQEFLDWVINTQETE |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (227-259) |
Receptor | Q8UVY5
Detail in HMRbase |
Gene ID | 373686 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |