Welcome to Peptide Card of AntiTbPdb
| This page displays user query in tabular form. |
VPAESEAAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN details |
| Primary information | |
|---|---|
| ID | antitb_1989, |
| Name | 25588982 |
| N-Terminal modification | Ds-defensin |
| C-Terminal Modification | VPAESEAAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 52 |
| Source | L |
| Species | Natural |
| Strain | Dermacentor silvarum |
| Inhibition Concentration | Mycobacterium bovis |
| In Vitro/ In vivo | Mycobacterium bovis (carbenicillin-resistant strain) |
| Cell Line | MIC= 20 µM |
| Inhibition Concentration | In vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial lycis |
| Other activities | Cell wall |
| PMID | NA |
| Year of Publication | Four Gram-positive bacteria, namely, Staphylococcus aureus (CMCC26003), Bacillus pumilus (CMCC63202), Micrococcus luteus (CMCC63202), and Mycobacterium bovis (carbenicillin-resistant strain); and three Gram-negative bacteria, namely, Salmonella typhimurium (CVCC542), Pseudomonas aeruginosa (CVCC2000), and Escherichia coli (CMCC44103), |
| Tertiary Structure (Technique) | Not Predicted), |