Detailed description page of AntiTbPdb
| This page displays user query in tabular form. |
antitb_1989 details |
| Primary information | |
|---|---|
| ID | antitb_1989 |
| Peptide Name | Ds-defensin |
| Sequence | VPAESEAAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 52 |
| Chirality | L |
| Nature | NA |
| Source | Natural |
| Origin | Dermacentor silvarum |
| Species | Mycobacterium bovis |
| Strain | Mycobacterium bovis (carbenicillin-resistant strain) |
| Inhibition Concentartion | MIC= 20 µM |
| In vitro/In vivo | In vitro |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Bacterial lycis |
| Target | Cell wall |
| Combination Therapy | NA |
| Other Activities | Four Gram-positive bacteria, namely, Staphylococcus aureus (CMCC26003), Bacillus pumilus (CMCC63202), Micrococcus luteus (CMCC63202), and Mycobacterium bovis (carbenicillin-resistant strain); and three Gram-negative bacteria, namely, Salmonella typhimurium (CVCC542), Pseudomonas aeruginosa (CVCC2000), and Escherichia coli (CMCC44103), |
| Pubmed ID | 25588982 |
| Year of Publication | 2015 |
| 3-D Structure | NA |