| Primary information |
|---|
| ID | antitb_1972, |
| Name | 9756476 |
| N-Terminal modification | Granulysin |
| C-Terminal Modification | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 123 |
| Source | Mix |
| Origin | Cationic |
| Species | Natural |
| Strain | Homo sapiens |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis |
| Cell Line | 90% Killing |
| Inhibition Concentration | In vivo |
| Sequence | 1988 |
| Cytotoxicity | CD8+ T |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Altering Membrane Permeability |
| Other activities | cell wall (lipid bilayer) |
| PMID | Perforin (2000 U/ml)+granulysin (25 µM) |
| Year of Publication | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1973, |
| Name | 9756476 |
| N-Terminal modification | Granulysin |
| C-Terminal Modification | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 123 |
| Source | Mix |
| Origin | Cationic |
| Species | Natural |
| Strain | Homo sapiens |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis |
| Cell Line | 10-15% Killing |
| Inhibition Concentration | In vivo |
| Sequence | 1988 |
| Cytotoxicity | CD8+ T |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Altering Membrane Permeability |
| Other activities | cell wall (lipid bilayer) |
| PMID | NA |
| Year of Publication | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus |
Tertiary Structure
(Technique) | Not Predicted), |