| Primary information |
|---|
| ID | antitb_1973 |
| Peptide Name | Granulysin |
| Sequence | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 123 |
| Chirality | Mix |
| Nature | Cationic |
| Source | Natural |
| Origin | Homo sapiens |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis |
| Inhibition Concentartion | 10-15% Killing |
| In vitro/In vivo | In vivo |
| Cell Line | CD8+ T |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Altering Membrane Permeability |
| Target | cell wall (lipid bilayer) |
| Combination Therapy | NA |
| Other Activities | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus |
| Pubmed ID | 9756476 |
| Year of Publication | 1988 |
| 3-D Structure | NA |