| Primary information |
|---|
| ID | antitb_1810, |
| Name | 21945146 |
| N-Terminal modification | Mcdef |
| C-Terminal Modification | GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | 4 disulfide linkages between 4-25, 10-31, 14-33, 20-36 |
| Chirality | Cyclic |
| Nature | 44 |
| Source | L |
| Origin | Cationic |
| Species | Protein Derived |
| Strain | detected in hemocytes of Manila clams (Ruditapes philippinarum). |
| Inhibition Concentration | Mycobacterium fortuitum |
| In Vitro/ In vivo | Mycobacterium fortuitum |
| Cell Line | MIC >20 μM |
| Inhibition Concentration | In vitro |
| Sequence | 2011 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Antibacterial (Staphylococcus aureus KCTC 1916, Streptococcus iniae KCTC 3651, orynebacterium diphtheriae, Bacillus subtilis, ibrio logei KCCM 12281, Vibrio salmonicida KCCM 41663) |
Tertiary Structure
(Technique) | Not Predicted), |