| Primary information |
|---|
| ID | antitb_1810 |
| Peptide Name | Mcdef |
| Sequence | GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | 4 disulfide linkages between 4-25, 10-31, 14-33, 20-36 |
| Linear/ Cyclic | Cyclic |
| Length | 44 |
| Chirality | L |
| Nature | Cationic |
| Source | Protein Derived |
| Origin | detected in hemocytes of Manila clams (Ruditapes philippinarum). |
| Species | Mycobacterium fortuitum |
| Strain | Mycobacterium fortuitum |
| Inhibition Concentartion | MIC >20 μM |
| In vitro/In vivo | In vitro |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other Activities | Antibacterial (Staphylococcus aureus KCTC 1916, Streptococcus iniae KCTC 3651, orynebacterium diphtheriae, Bacillus subtilis, ibrio logei KCCM 12281, Vibrio salmonicida KCCM 41663) |
| Pubmed ID | 21945146 |
| Year of Publication | 2011 |
| 3-D Structure | NA |