Browse result page of AntiTbPdb
The total number entries retrieved from this search are 650
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1291 | Bcn5 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | C57BL/6JCit (B6) feamale mice of age 14 | 10 mg/mouse of Bcn5 | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1292 | Bcn5 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | NA | Both | Mouse macrophages | No inhibition | No cytotoxicty | C57BL/6JCit (B6) feamale mice of age 15 | 10 mg/mouse of Bcn5-PhC complex | NA | Formation of pores in cell membranes | Cell envelope | Mixture of phosphatidylcholine (Ph) and cardiolipin (C) with Bcn5 | None | 2007 | 17347179 |
| antitb_1302 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 1.5 fold reduction in bacterial colony as compared to control at 50 μM of peptide | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
| antitb_1303 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 1.5 fold reduction in bacterial colony as compared to control at 60 μM of peptide | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
| antitb_1304 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 2.5 fold reduction in bacterial colony as compared to control at75 μM | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
| antitb_1305 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 3 fold reduction in bacterial colony as compared to control at100 μM | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
| antitb_1316 | L-LL37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRN | Free | Free | None | Linear | 31 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = Ie μg/mL(inactive) | In vitro | Human erythrocyte | NA | HC50 = 43.5 μg/mL | NA | NA | NA | NA | NA | NA | NA | 2011 | 20858205 |
| antitb_1317 | D-LL37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRN | Free | Free | None | Linear | 31 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 200 μg/mL | In vitro | Human erythrocyte | NA | HC50 = 125 μg/mL | NA | NA | NA | NA | NA | NA | NA | 2011 | 20858205 |
| antitb_1330 | Human beta casein fragment (54-59) | VEPIPY | Free | Free | None | Linear | 6 | L | Cationic | Protein derived | Human beta casein protein | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 25μM | in vitro | THP 1 cell lines | Cells treated with 10 mM and 20 mM peptide showed 17.13% and 29.56% increase in clearance of BCG | NA | NA | NA | Increase expression of IL-8, MCP-1, MIP-1β, TNF-α | NA | NA | NA | NA | 2012 | 23029305 |
| antitb_1331 | Innate defence regulator peptide HH2 | VQLRIRVAVIRA | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
| antitb_1332 | Innate defence regulator peptide 1002 | VQRWLIVWRIRK | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 29.3 ± 11.8 mg/mL | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
| antitb_1333 | Innate defence regulator peptide 1018 | VRLIVAVRIWRR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 16.4± 5.4 mg/mL | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
| antitb_1335 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50 = <0.0125 μg/mL (50%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 10 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1336 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium intracellulare | Mycobacterium intracellulare | IC50 = 1.56 μg/mL (50%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 11 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1337 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium kansasii | Mycobacterium kansasii | IC50= 0.39 μg/mL (50%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 12 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1338 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC90= 0.05 μg/mL(90%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 13 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1339 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium intracellulare | Mycobacterium intracellulare | IC90= 0.78 μg/mL(90%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 14 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1340 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium kansasii | Mycobacterium kansasii | IC90= 0.78 μg/mL(90%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 15 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1341 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium bovis | Mycobacterium tuberculosis H37Rv | NA | Both | NA | NA | NA | ICR/JCL Mice | 15 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | 4mg of DHMPA peptide+ 0.1 mg of Isoniazid | NA | 1988 | 3348603 |
| antitb_1342 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium tuberculosis | Mycobacterium tuberculosis R-KM | NA | Both | NA | NA | NA | ICR/JCL Mice | 15 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | 4mg of DHMPA peptide+ 0.1 mg of Isoniazid | NA | 1988 | 3348603 |
| antitb_1343 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | FIC= 0.250 - 0.375 | NA | NA | NA | NA | NA | NA | NA | NA | NA | DHMPA+ Isoniazid | NA | 1988 | 3348603 |
| antitb_1353 | Peptide KSl | KKVVFKVKFK | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = 6.25μg/ml | In vitro | Mouse erythrocyte | NA | None | NA | NA | NA | NA | NA | NA | antifungal, antibacterial against C.albicans | 1998 | 9756752 |
| antitb_1354 | Nk-lysin | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD | Free | Free | Internal disuphide bond 13 -23 | Cyclic | 37 | L | NA | Natural | Pig cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25618 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 30 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1355 | NKLF1 | VTQAASRVCDKMKILRGVCKKIMRTFLRR | Free | Free | Internal disulphide bond at residue between 9-13 | Cyclic | 29 | L | NA | Natural | Pig cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25619 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 31 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1356 | NKLF2 | VCDKMKILRGVCKKIMRTFLRR | Free | Free | None | Cyclic | 22 | L | NA | Natural | Pig cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25620 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 32 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1357 | Gran F2 | VCRTGRSRWRDVCRNFMRRYQSR | Free | Free | Internal disulphide bond at residue between 2-13 | Cyclic | 23 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25621 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 33 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1358 | Gran F1 | VSNAATRVCRTGRSRWRDVCRNFMRRYQSR | Free | Free | None | Linear | 30 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25622 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 34 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1359 | Granulysin | TQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQG | Free | Free | None | Linear | 38 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25623 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 35 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1360 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 80 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
| antitb_1361 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 20 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | 185 μM OF D-CYCLOSERINE DRUG + 5.2 μM OF Peptide reduces ~ 4 time MIC of drug | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
| antitb_1370 | Human neutrophil peptides-1 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | cyclic | 30 | L | Cationic | Synthetic | Human neutrophils | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | NA | in vitro | None | NA | NA | NA | NA | NA | NA | Mycobacterial genomic DNA | NA | antibacterial against candida albicans | 2000 | 11375668 |
| antitb_1371 | Mycobacterial tuberculosis DHFR tripeptide analog | WYD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.26 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1372 | Mycobacterial tuberculosis DHFR tripeptide analog | WYE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 5.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1373 | Mycobacterial tuberculosis DHFR tripeptide analog | WPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.12 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1374 | Mycobacterial tuberculosis DHFR tripeptide analog | WPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1375 | Mycobacterial tuberculosis DHFR tripeptide analog | YPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.17 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1376 | Mycobacterial tuberculosis DHFR tripeptide analog | YPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.75 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1377 | Mycobacterial tuberculosis DHFR tripeptide analog | WYY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.78 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1378 | Mycobacterial tuberculosis DHFR tripeptide analog | WPY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.55 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1379 | Mycobacterial tuberculosis DHFR tripeptide analog | WYP | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.57 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1380 | Mycobacterial tuberculosis DHFR tripeptide analog | WPW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.27 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1381 | Mycobacterial tuberculosis DHFR tripeptide analog | WYW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.45 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1382 | Mycobacterial tuberculosis DHFR tripeptide analog | WYS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.44 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1383 | Mycobacterial tuberculosis DHFR tripeptide analog | WPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 7.94 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1384 | Mycobacterial tuberculosis DHFR tripeptide analog | WPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.95 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1385 | Mycobacterial tuberculosis DHFR tripeptide analog | WYT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 3.31 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1386 | Mycobacterial tuberculosis DHFR tripeptide analog | YPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 8.91 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1387 | Mycobacterial tuberculosis DHFR tripeptide analog | YPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 6.46 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1388 | Hepcidin | DTHFPICIFCCGCCHRSKCGMCCKT | Free | Free | Disulphide linkage between cys7-23, cys10-13, cys11-19,cys14-22 | Cyclic | 25 | L | Cationic | Natural | Human alveolar type 2 epithilium | Mycobacterium tuberculosis | Mycobacterium H37Rv | NA | in vivo | A549 cell line | NA | No cytotoxicity | BALB/C | NA | Increased production of TNF-α, IL-1α | NA | Mycobacterium tuberculosis + IFN-Υ | antimicrobial | 2011 | 21482189 | |
| antitb_1389 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 14% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |