Browse result page of AntiTbPdb
The total number entries retrieved from this search are 650
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1164 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 15.8 ± 4.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1165 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 =34.6 ± 22.4 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1166 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 11.0 ± 4.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1167 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 65.8 ± 19.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1168 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 15.2 ± 2.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1169 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 =37.9 ± 15.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1170 | hLFcin1-11 all K | GKKKKSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 39.1 ± 6.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1171 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 14.2 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1172 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 18.9 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1173 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 8.0 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1174 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 22.8 ± 9.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1175 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 12.4 ± 0.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1176 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 = 21.5 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1177 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.7 ± 0.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1178 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 14.4 ± 1.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1179 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 18.0 ± 2.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1180 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 34.4 ± 8.2 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1181 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.8 ± 1.6 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1182 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 19.3 ± 4.8 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1183 | SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | Free | None | Linear | 33 | L | NA | Natural | Isolated from lung cDNA library | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | None | None | 2014 | 25349777 |
| antitb_1185 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 57.7 ± 22.3 μg/ml or 22.1 ± 8.6 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1186 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 86.5 μg/ml or 33.1 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1187 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1188 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1189 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 80.1 ± 24.8 μg/ml or 29 ± 9 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1190 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 17.4 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1191 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin2 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20 ± 6.92 μg/ml or 11.92 ± 3.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1192 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 10 ± 3.1 μg/ml or 6 ± 1.8 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1193 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 22 ± 4.9 μg/ml or 11.65 ± 2.59 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1194 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 28.0 ± 9.8 μg/ml or 14.85 ± 5.2 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1219 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 69 % decrease in CFU at 50 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 77.8% at 1.25 mg | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
| antitb_1220 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 88 % decrease in CFU at 100 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 95.8% at 2.5 mg k | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
| antitb_1221 | PK34 | PRVIETKVHGREVTGLARNVSEENVDRLAKRWIK | Free | Free | None | Linear | 34 | L | Cationic | Synthetic | Searched and selected from mycobacteriophage genome sequences | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strain (ATCC 27294 | MIC = 50 μg/ml | Both | Murine macrophage-like J774A.1 | NA | NA | Four-week-old female BALB/c mice | Dose of 20 mg (5×10−6 mol)/kg BW/d, PK34 had co | Inhibits the proinflammatory factor (IFN-γ, TNF-α, MCP-1, IL-6, IL-10, IL-12) production of macrophage cells induced by TDM. | Cell wall disruption | trehalose-6,6=-dimycolate (TDM) | None | None | 2013 | 23603838 |
| antitb_1222 | Peptide | SEFAYGSFVRTVSLPV | Conjugated with INH | Free | Conjugated with INH at N-terminal | Linear | 16 | L | NA | Protein Derived | 91−106 region of the heat shock protein (Hsp16.3) | None | None | NA | NA | NA | NA | NA | NA | NA | NA | Interact with Phospholipid Langmuir Monolayers and enhnaces the cell permating abiloity of INH | Phospholipid Langmuir Monolayers | Isoniazide (INH) | None | 2013 | 23679078 |
| antitb_1223 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-29 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 96.5 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
| antitb_1224 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-30 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 98.3 % inhibition at 15 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
| antitb_1225 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-31 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | 36 Clinical isolates of Mycobacterium tuberculosis | 11 isolates (31%) showed greater sensitivity to HNP-1 than H37Rv strains. At 15 μg/ml, they wer completely inhibited. | In vitro | THP-1 cells | Sixteen clinical isolates had lower intracellular growth ability than the H37Rv strain. | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
| antitb_1226 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-32 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 99.6 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
| antitb_1227 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-33 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 100 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
| antitb_1228 | High Activity Binding Peptides (HABPs) | TGMAALEQYLGSGHAVIVSI | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | alveolar epithelial cells A549 (ATCC No. CCL-185) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
| antitb_1229 | High Activity Binding Peptides (HABPs) | AVALGLASPADAAAGTMYGD | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | U937 monocyte derived macrophages (ATCC No. CRL-1593.2) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
| antitb_1230 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1231 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1232 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1233 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1234 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1235 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1236 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 250 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1237 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1238 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |