Welcome to Peptide Card of AntiTbPdb
| This page displays user query in tabular form. |
AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW details |
| Primary information | |
|---|---|
| ID | antitb_1183, |
| Name | 25349777 |
| N-Terminal modification | SL3 |
| C-Terminal Modification | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 33 |
| Source | L |
| Species | Natural |
| Strain | Isolated from lung cDNA library |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | 45% reduction in growth was observed |
| Inhibition Concentration | Both |
| Sequence | 2014 |
| Cytotoxicity | THP-1 cells |
| In vivo Model | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection |
| Lethal Dose | No cytotoxicty |
| Immune Responce | BALB/c female mice at 6–8 weeks of age |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Disruption in mycobacterila secretory and cell wall biosynthetic pathway |
| Other activities | Molecules specific to mycobacterial cell |
| PMID | None |
| Year of Publication | None |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1184, |
| Name | 25349777 |
| N-Terminal modification | H37Rv/SL3 |
| C-Terminal Modification | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW |
| Chemical Modification | Free |
| Linear/Cyclic | 6-histidine |
| Length | None |
| Chirality | Linear |
| Nature | 33 |
| Source | L |
| Species | Natural |
| Strain | Expressing SL3-His6X endogenously |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | 45% reduction in growth was observed |
| Inhibition Concentration | Both |
| Sequence | 2014 |
| Cytotoxicity | THP-1 cells |
| In vivo Model | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection |
| Lethal Dose | No cytotoxicty |
| Immune Responce | BALB/c female mice at 6–8 weeks of age |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Disruption in mycobacterila secretory and cell wall biosynthetic pathway |
| Other activities | Molecules specific to mycobacterial cell |
| PMID | Endogenously produced with in M.tb |
| Year of Publication | None |
| Tertiary Structure (Technique) | Not Predicted), |