Browse result page of AntiTbPdb
The total number entries retrieved from this search are 650
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1902 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC50 = 8.0 ± 1.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1903 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC90 = 22.8 ± 9.1 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1904 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC50 = 12.4± 0.3 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1905 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC90 = 21.5± 4.0 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1906 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1907 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1908 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1909 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1910 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1911 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1912 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 8 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1913 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis mc2 6020 | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1914 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG pasteur strain | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |
| antitb_1950 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO01 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1951 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO06 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1952 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO08 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1953 | Wollamide- B | WAlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1954 | Wollamide- B | ALlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1955 | Wollamide- B | WLlVAx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 20 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1956 | Wollamide- B | WLlANx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1957 | Wollamide- B | WLaVNx | Free | Free | Third residue is D-alanine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1958 | Wollamide- B | WLlINx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1959 | Wollamide- B | WLlMNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1960 | Wollamide- B | WLlVxx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =2.5 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1961 | Wollamide- B | WLlISx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =15 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1962 | Wollamide- B | WLlIXx | Free | Free | Third residue is D-leucine, fifth residue is tertiary butyl serine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1963 | Wollamide- B | WLlIIx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 3.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1964 | Wollamide- B | WLlINr | Free | Free | Third residue is D-leucine and r= D- arginine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.6 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1965 | Wollamide- B | xLlVNx | Free | Free | First residue is D- phenyalanine, Third is D-leucine and sixth is D-ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1966 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.2 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1967 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1968 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1969 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1971 | Sapecin | ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN | Free | Free | None | Linear | 40 | L | Cationic | Natural | NIH-Sape-4, an Embryonic Cell Line of Sarcophaga peregrina | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | 78 μg/ml | In vitro | None | None | NA | NA | None | NA | NA | cell wall (lipid bilayer) | NA | Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus FDA16, Micrococcus luteus IF03333, Micrococcus luteus PC11001, Bacillus subtilis NRRI B-558, Bacillus subtilis PC1219, Corynebacterium bouis 1810, Corynebacterium michiganense, Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli NIHJ, Shigella sonnei JS11746, Proteus vulgaris OX19 | 1988 | 3182836 |
| antitb_1972 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 90% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | Perforin (2000 U/ml)+granulysin (25 µM) | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
| antitb_1973 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 10-15% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | NA | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
| antitb_1980 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1981 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1982 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1983 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1984 | Granulysin(31-50) | TRVSRTGRSRWRDVSRNFMR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 20 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1985 | Granulysin(31-50) | TRVSRTGRSRWRDVSRNFMR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 20 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1988 | Teixobactin | FISQIISTAI | Free | Free | adenylation, C, condensation; MT, methylation (of phenylalanine); T, thiolation (carrier); and TE,thioesterase (Ile-Thr ring closure). NmPhe,N-methylated phenylalanin | Cyclic | 10 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 0.125µg/ml | In vitro | NA | NA | NA | NA | NA | NA | Binding of teixobactin to WTA precursor contributes to efficient lysis and killing, due to digestion of the cell wall by liberated autolysins | Cell wall | NA | S. aureus (MSSA), S. aureus 110% serum, S. aureus (MRSA), Enterococcus faecalis (VRE), Enterococcus faecium (VRE), Streptococcus pneumoniae (penicillinR), Streptococcus pyogenes, Streptococcus agalactiae, Viridans group streptococci, B. anthracis, Clostridium difficile, Propionibacterium acnes, Haemophilus influenzae, Moraxella catarrhalis, Escherichia coli, Escherichia coli (asmB1), Pseudomonas aeruginosa, Klebsiella pneumoniae | 2015 | 25561178 |
| antitb_1989 | Ds-defensin | VPAESEAAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN | Free | Free | None | Linear | 52 | L | NA | Natural | Dermacentor silvarum | Mycobacterium bovis | Mycobacterium bovis (carbenicillin-resistant strain) | MIC= 20 µM | In vitro | NA | NA | NA | NA | NA | NA | Bacterial lycis | Cell wall | NA | Four Gram-positive bacteria, namely, Staphylococcus aureus (CMCC26003), Bacillus pumilus (CMCC63202), Micrococcus luteus (CMCC63202), and Mycobacterium bovis (carbenicillin-resistant strain); and three Gram-negative bacteria, namely, Salmonella typhimurium (CVCC542), Pseudomonas aeruginosa (CVCC2000), and Escherichia coli (CMCC44103), | 2015 | 25588982 |
| antitb_1994 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 21.4 ± 7.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1995 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 30.5 ± 9.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1996 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 13.6 ± 5.3 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1997 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 8.5 ± 2.6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1998 | Apidaecin Ia acid( A24 C3) | GNNRPVYIPQPRPPHPRI | Free | Free | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = >125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |