Primary information |
---|
ID | antitb_1967 |
Peptide Name | HIDFS2 |
Sequence | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 34 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | Derived from Haemaphysalis longicornis |
Species | Mycobacterium bovis |
Strain | Mycobacterium bovis |
Inhibition Concentartion | MIC50 = 0.5μM |
In vitro/In vivo | In vitro |
Cell Line | A549, 293 T, K562 and THP1 cells |
Inhibition Concentartion | NA |
Cytotoxicity | No cytotoxicity at 20 μM |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other Activities | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli |
Pubmed ID | 28446822 |
Year of Publication | 2017 |
3-D Structure | NA |