Browse result page of ThPDB2
This is the result page of the browse module of ThPDB2. This page gives the information about the query submitted by the user as per the browse category. Further details of the entries can be seen by clicking on the ID or THPP_ID. Further the user can sort the entries on the basis of various fields by clicking on the respective headers. The user can also download the results in various formats.
Tabular representation:
| ID | THPP_ID | Therapeutic Name | Sequence | Molecular Weight | Chemical Formula | Isoelectric Point | Hydrophobicity | Melting Point | Half Life | Description | Disease/Indication | Pharmacodynamics | Mechanism of Action | Toxicity | Metabolism | Absorption | Volume of Distribution | Clearance | Categories | Patent Number | Date of Issue | Date of Expiry | Drug Interaction | Target | Brand Name | Company | Brand Description | Prescribed for | Chemical Name | Formulation | Physical Appearance | Route of Administation | Recommended Dosage | Contraindication | Side Effects | Useful Links 1 | Useful Links 2 | Remarks |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10470 | Th1084 | Becaplermin | >Th1084_Becaplermin SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT | 12294.4 | C532H892N162O153S9 | 9.38 | -0.16 | NA | NA | Recombinant platelet derived growth factor (PDGF), the gene for B chain, produced in yeast by cloning and expression of, Saccharomyces cerevisiae. Molecular weight ~25 KD is the homodimer composed of two identical polypeptide chains linked by disulfide bonds. | For topical treatment of skin ulcers (from diabetes) | Used for the topical treatment of skin ulcers, Regranex has a biological activity similar to that of endogenous platelet-derived growth factor, which includes promoting the chemotactic recruitment and proliferation of cells involved in wound repair and enhancing the formation of granulation tissue. | Binds to the beta platelet-derived growth factor (PDGF) receptor, a tyrosine kinase receptor. PDGF is known to exist as a dimer, and activates its signaling pathway by a ligand induced receptor dimerization and autophosphorylation. PDGF receptors also contain many auto-phosphorylation sites, which serve to mediate binding of SH2 sites and subsequently signal corresponding pathways. There are five different isoforms of PDGF that activate through two different receptors (alpha and beta). | NA | NA | very little systemic absorption. 15% of patients experienced complete healing within 8 weeks, while for 25% of patients, it was at 10 weeks. | NA | NA | Acids,Acids, Noncarboxylic,Alimentary Tract and Metabolism,Amino Acids, Peptides, and Proteins,Angiogenesis Inducing Agents,Angiogenesis Modulating Agents,Anions,Biological Factors,Blood Proteins,Cicatrizants,Dermatologicals,DNA-Binding Proteins,Electrolytes,Growth Substances,Hematologic Agents,Human Platelet-derived Growth Factor,Intercellular Signaling Peptides and Proteins,Ions,Neoplasm Proteins,Oncogene Proteins,Peptides,Phosphoric Acids,Phosphorus Acids,Phosphorus Compounds,Platelet-Derived Growth Factor,Preparations for Treatment of Wounds and Ulcers,Proteins,Proto-Oncogene Proteins,Proto-Oncogene Proteins c-sis,Stomatological Preparations | CA1340846 | 7-Dec-1999 | 7-Oct-2005 | NA | Platelet-derived growth factor receptor beta,Platelet-derived growth factor receptor alpha,Alpha-2-macroglobulin | REGRANEX | OMJ Pharmaceuticals, Inc. San German, Puerto Rico | OMJ Pharmaceuticals, Inc. San German, Puerto Rico | for the treatment of lower extremity diabetic neuropathic ulcers that extend into the subcutaneous tissue or beyond and have an adequate blood supply, when used as an adjunct to, and not a substitute for, good ulcer care practices including initial sharp debridement, pressure relief and infection control. | NA | 0.01 % clear to straw-colored gel | Gel: 0.01 %; clear, colorless to straw-colored gel | For topical use; not for oral, ophthalmic or intra | Gel to be applied will vary depending upon the size of the ulcer area. | A very serious allergic reaction to this drug is rare. However, seek immediate medical attention if you notice any symptoms of a serious allergic reaction, including: rash, itching/swelling (especially of the face/tongue/throat), severe dizziness, trouble breathing. | hives; difficulty breathing; swelling of your face, lips, tongue, or throat. | Link | NA | NA |