|
| Primary information |
|---|
| ID | 10470 |
| Therapeutic ID | Th1084 |
| Protein Name | Becaplermin |
| Sequence | >Th1084_Becaplermin
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
|
| Molecular Weight | 12294.4 |
| Chemical Formula | C532H892N162O153S9 |
| Isoelectric Point | 9.38 |
| Hydrophobicity | -0.16 |
| Melting point | NA |
| Half-life | NA |
| Description | Recombinant platelet derived growth factor (PDGF), the gene for B chain, produced in yeast by cloning and expression of, Saccharomyces cerevisiae. Molecular weight ~25 KD is the homodimer composed of two identical polypeptide chains linked by disulfide bonds. |
| Indication/Disease | For topical treatment of skin ulcers (from diabetes) |
| Pharmacodynamics | Used for the topical treatment of skin ulcers, Regranex has a biological activity similar to that of endogenous platelet-derived growth factor, which includes promoting the chemotactic recruitment and proliferation of cells involved in wound repair and enhancing the formation of granulation tissue. |
| Mechanism of Action | Binds to the beta platelet-derived growth factor (PDGF) receptor, a tyrosine kinase receptor. PDGF is known to exist as a dimer, and activates its signaling pathway by a ligand induced receptor dimerization and autophosphorylation. PDGF receptors also contain many auto-phosphorylation sites, which serve to mediate binding of SH2 sites and subsequently signal corresponding pathways. There are five different isoforms of PDGF that activate through two different receptors (alpha and beta). |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | very little systemic absorption. 15% of patients experienced complete healing within 8 weeks, while for 25% of patients, it was at 10 weeks. |
| NA |
| Clearance | NA |
| Categories | Acids,Acids, Noncarboxylic,Alimentary Tract and Metabolism,Amino Acids, Peptides, and Proteins,Angiogenesis Inducing Agents,Angiogenesis Modulating Agents,Anions,Biological Factors,Blood Proteins,Cicatrizants,Dermatologicals,DNA-Binding Proteins,Electrolytes,Growth Substances,Hematologic Agents,Human Platelet-derived Growth Factor,Intercellular Signaling Peptides and Proteins,Ions,Neoplasm Proteins,Oncogene Proteins,Peptides,Phosphoric Acids,Phosphorus Acids,Phosphorus Compounds,Platelet-Derived Growth Factor,Preparations for Treatment of Wounds and Ulcers,Proteins,Proto-Oncogene Proteins,Proto-Oncogene Proteins c-sis,Stomatological Preparations |
| Patents Number | CA1340846 |
| Date of Issue | 7-Dec-1999 |
| Date of Expiry | 7-Oct-2005 |
| Drug Interaction | NA |
| Target | Platelet-derived growth factor receptor beta,Platelet-derived growth factor receptor alpha,Alpha-2-macroglobulin |
| Brand Name | REGRANEX |
| Company | OMJ Pharmaceuticals, Inc. San German, Puerto Rico |
| Brand Description | OMJ Pharmaceuticals, Inc. San German, Puerto Rico |
| Prescribed For | for the treatment of lower extremity diabetic neuropathic ulcers that extend into the subcutaneous tissue or beyond and have an adequate blood supply, when used as an adjunct to, and not a substitute for, good ulcer care practices including initial sharp debridement, pressure relief and infection control. |
| Chemical Name | NA |
| Formulation | 0.01 % clear to straw-colored gel |
| Physical Appearance | Gel: 0.01 %; clear, colorless to straw-colored gel |
| Route of Administration | For topical use; not for oral, ophthalmic or intra |
| Recommended Dosage | Gel to be applied will vary depending upon the size of the ulcer area. |
| Contraindication | A very serious allergic reaction to this drug is rare. However, seek immediate medical attention if you notice any symptoms of a serious allergic reaction, including: rash, itching/swelling (especially of the face/tongue/throat), severe dizziness, trouble breathing. |
| Side Effects | hives; difficulty breathing; swelling of your face, lips, tongue, or throat. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |