| Primary information |
|---|
| SALID | SAL_16065 |
| Biomarker name | Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-a |
| Biomarker Type | NA |
| Sampling Method | Age 42-70, Male |
| Collection Method | Whole stimulated saliva was collected pre- and post-treatment (12 months post-diagnosis). |
| Analysis Method | MILLIPLEX MAP Cytokine/Chemokine Magnetic Bead Panel Immunology Multiplex Assay (Millipore, Billerica, MA) according to the manufacturer’s instructions. |
| Collection Site | Whole Saliva |
| Disease Category | Cancer |
| Disease/Condition | Head and Neck Cancer |
| Disease Subtype | NA |
| Fold Change/ Concentration | 8.4443734 |
| Up/Downregulated | Upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 27554375 |
| Year of Publication | 2016 |
| Biomarker ID | P09341 |
| Biomarker Category | Protein |
| Sequence | MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
| Title of study | Cytokines in saliva increase in head and neck cancer patients after treatment |
| Abstract of study | OBJECTIVE: Approximately one-third of advanced head and neck squamous cell carcinomas (HNSCCs) recur within 2 years of treatment. Due to ease of collection, saliva is of interest to monitor changes that correlate with treatment. Previously this was a challenge due to xerostomia after conventional radiation. The emergence of gland-sparing radiation has made it possible to collect saliva post-treatment. This study investigated changes in cytokines in saliva pre- and post-treatment to provide foundational knowledge for future studies exploring the use of saliva to monitor treatment response.STUDY DESIGN: Pre- and post-treatment saliva was evaluated for 8 cytokines by multiplex assay and enzyme-linked immunosorbent assay.RESULTS: In oropharyngeal HNSCC, secretion of epidermal growth factor (EGF), GROα (Growth-regulated protein alpha), interleukin (IL)-1α, IL-β, IL-6, IL-8, tumor necrosis factor-α, and vascular endothelial growth factor increased significantly post-treatment. In additional patients, significant increases of GR-α and IL-6 were validated, but EGF showed no change.CONCLUSIONS: The uniqueness of this study is its comparison of salivary cytokines from HNSCC patients pre- and post-treatment. |