Primary information |
---|
SALID | SAL_16061 |
Biomarker name | Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular |
Biomarker Type | NA |
Sampling Method | Age 42-70, Male |
Collection Method | Whole stimulated saliva was collected pre- and post-treatment (12 months post-diagnosis). |
Analysis Method | MILLIPLEX MAP Cytokine/Chemokine Magnetic Bead Panel Immunology Multiplex Assay (Millipore, Billerica, MA) according to the manufacturer’s instructions. |
Collection Site | Whole Saliva |
Disease Category | Cancer |
Disease/Condition | Head and Neck Cancer |
Disease Subtype | NA |
Fold Change/ Concentration | 6.64940239 |
Up/Downregulated | Upregulated |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 27554375 |
Year of Publication | 2016 |
Biomarker ID | P01375 |
Biomarker Category | Protein |
Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
Title of study | Cytokines in saliva increase in head and neck cancer patients after treatment |
Abstract of study | OBJECTIVE: Approximately one-third of advanced head and neck squamous cell carcinomas (HNSCCs) recur within 2 years of treatment. Due to ease of collection, saliva is of interest to monitor changes that correlate with treatment. Previously this was a challenge due to xerostomia after conventional radiation. The emergence of gland-sparing radiation has made it possible to collect saliva post-treatment. This study investigated changes in cytokines in saliva pre- and post-treatment to provide foundational knowledge for future studies exploring the use of saliva to monitor treatment response.STUDY DESIGN: Pre- and post-treatment saliva was evaluated for 8 cytokines by multiplex assay and enzyme-linked immunosorbent assay.RESULTS: In oropharyngeal HNSCC, secretion of epidermal growth factor (EGF), GROα (Growth-regulated protein alpha), interleukin (IL)-1α, IL-β, IL-6, IL-8, tumor necrosis factor-α, and vascular endothelial growth factor increased significantly post-treatment. In additional patients, significant increases of GR-α and IL-6 were validated, but EGF showed no change.CONCLUSIONS: The uniqueness of this study is its comparison of salivary cytokines from HNSCC patients pre- and post-treatment. |