| Primary information |
|---|
| SALID | SAL_15982 |
| Biomarker name | C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10) [Cleaved into: CXCL10(1-73)] |
| Biomarker Type | NA |
| Sampling Method | NA |
| Collection Method | NA |
| Analysis Method | NA |
| Collection Site | NA |
| Disease Category | Metabolic Disorder |
| Disease/Condition | Diabetes Mellitus, Type 2 |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | Upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 26018641 |
| Year of Publication | 2015 |
| Biomarker ID | P02778 |
| Biomarker Category | Protein |
| Sequence | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Title of study | Transcriptional regulation of chemokine genes: a link to pancreatic islet inflammation? |
| Abstract of study | Enhanced expression of chemotactic cytokines (aka chemokines) within pancreatic islets likely contributes to islet inflammation by regulating the recruitment and activation of various leukocyte populations, including macrophages, neutrophils, and T-lymphocytes. Because of the powerful actions of these chemokines, precise transcriptional control is required. In this review, we highlight what is known about the signals and mechanisms that govern the transcription of genes encoding specific chemokine proteins in pancreatic islet β-cells, which include contributions from the NF-κB and STAT1 pathways. We further discuss increased chemokine expression in pancreatic islets during autoimmune-mediated and obesity-related development of diabetes. |