| Primary information |
|---|
| SALID | SAL_15755 |
| Biomarker name | Oxytocin-neurophysin 1 |
| Biomarker Type | NA |
| Sampling Method | ASD age group: 11,7. TD group: 9,5, Inclusion criteria - DSM-IV-TR |
| Collection Method | Sallivatte (Sarstedt, Rommelsdorft, Germany). |
| Analysis Method | Samples were concentrated by four (lyophilised), Protein measurements (ELISA kit), Sample concentrations (MATLAB 7) |
| Collection Site | Whole Saliva |
| Disease Category | Developmental Disorder |
| Disease/Condition | Autism Spectrum Disorder |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | Downregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 24855128 |
| Year of Publication | 2014 |
| Biomarker ID | P01178 |
| Biomarker Category | Protein |
| Sequence | MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR |
| Title of study | Parent-child interaction and oxytocin production in pre-schoolers with autism spectrum disorder |
| Abstract of study | BACKGROUND: Autism spectrum disorder (ASD) is associated with genetic risk on the oxytocin system, suggesting oxytocin involvement in ASD; yet oxytocin functioning in young children with ASD is unknown.AIMS: To assess baseline oxytocin in pre-schoolers with ASD and test whether oxytocin production may be enhanced by parent-child contact.METHOD: Forty pre-schoolers with high-functioning ASD were matched with 40 typically developing controls. Two home visits included an identical 45-minute social battery once with the mother and once with the father. Four saliva oxytocin samples were collected from each parent and the child during each visit.RESULTS: Children with ASD had lower baseline oxytocin. Following 20 min of parent-child interactions, oxytocin normalised and remained high during social contact. Fifteen minutes after contact, oxytocin fell to baseline. Oxytocin correlated with parent-child social synchrony in both groups.CONCLUSIONS: Oxytocin dysfunction in ASD is observed in early childhood. The quick improvement in oxytocin production following parent-child contact underscores the malleability of the system and charts future directions for attachment-based behavioural and pharmacological interventions. |