| Primary information |
|---|
| SALID | SAL_15751 |
| Biomarker name | Interleukin-1 beta (IL-1 beta) (Catabolin) |
| Biomarker Type | NA |
| Sampling Method | Age 62-75 |
| Collection Method | At the beginning of the oral examination, the subjects chewed a piece of paraffin for 5 min and at least 2 ml of stimulated whole saliva was collected. The samples were stored at -70 degree °C until analyses. |
| Analysis Method | IL-1β was measured by flow cytometry -based Luminex technology, with commercially available kits (Milliplex Map Kit MPXHCYTO-60k, Millipore, Billerica, MA, USA) with a detection limit of 0.4 pg/ml. |
| Collection Site | Whole Saliva |
| Disease Category | Dental Disorder |
| Disease/Condition | Chronic periodontitis |
| Disease Subtype | NA |
| Fold Change/ Concentration | 3.3 |
| Up/Downregulated | Upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 24460823 |
| Year of Publication | 2014 |
| Biomarker ID | P01584 |
| Biomarker Category | Protein |
| Sequence | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Title of study | Salivary biomarkers of bacterial burden, inflammatory response, and tissue destruction in periodontitis |
| Abstract of study | AIM: Chronic periodontitis has an episodic and multifactorial character, with fluctuations in bacterial burden, inflammatory response, and tissue destruction. We investigated the association of selected salivary biomarkers with periodontal parameters and validated the use of a novel salivary diagnostic approach, the cumulative risk score (CRS), in detection of periodontitis in subjects with angiographically verified coronary artery disease diagnosis.MATERIALS AND METHODS: The concentrations of matrix metalloproteinase (MMP)-8, interleukin (IL)-1β, and Porphyromonas gingivalis were analysed from saliva of 493 subjects. The subjects participated in a detailed clinical and radiographic oral examination. The CRS index, combining the three salivary biomarkers, was calculated for each subject.RESULTS: High salivary concentrations of MMP-8, IL-1β, and P. gingivalis were associated with deepened periodontal pockets and alveolar bone loss, and MMP-8 and IL-1β with bleeding on probing. The CRS index had a stronger association with moderate to severe periodontitis (OR 6.13; 95% CI 3.11-12.09) than any of the markers alone.CONCLUSIONS: Salivary concentrations of MMP-8, IL-1β, and P. gingivalis are associated with various clinical and radiographic measures of periodontitis. The CRS index, combining the three salivary biomarkers, is associated with periodontitis more strongly than any of the markers alone regardless of the coronary artery disease status of the patients. |