Primary information |
---|
SALID | SAL_15270 |
Biomarker name | Interleukin-1 receptor antagonist protein (IL-1RN) (IL-1ra) (IRAP) (ICIL-1RA) (IL1 inhibitor) (Anakinra) |
Biomarker Type | NA |
Sampling Method | Male and Female |
Collection Method | The saliva samples were then centrifuged at 14,000 g for 20 minutes at 4 degree C in order to remove any debris, cells and food particles present. |
Analysis Method | electrospray (LC/MS/MS) mass spectrometry with automatic database analysis (Proteomics International, Perth, Australia). |
Collection Site | Whole Saliva |
Disease Category | Metabolic Disorder |
Disease/Condition | Diabetes Mellitus, Type 2 |
Disease Subtype | NA |
Fold Change/ Concentration | -4.132 |
Up/Downregulated | Downregulated |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 22606001 |
Year of Publication | 2012 |
Biomarker ID | P18510 |
Biomarker Category | Protein |
Sequence | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Title of study | Salivary proteins associated with periodontitis in patients with Type 2 diabetes mellitus |
Abstract of study | The objective of this study was to investigate the salivary proteins that are associated with periodontitis in patients with Type 2 diabetes mellitus (T2DM). Volunteers for the study were patients from the Diabetic Unit, University of Malaya Medical Centre, whose periodontal status was determined. The diabetic volunteers were divided into two groups, i.e., patients with periodontitis and those who were periodontally healthy. Saliva samples were collected and treated with 10% TCA/acetone/20 mM DTT to precipitate the proteins, which were then separated using two-dimensional polyacrylamide gel electrophoresis. Gel images were scanned using the GS-800(TM) Calibrated Densitometer. The protein spots were analyzed and expressed in percentage volumes. The percentage volume of each protein spot was subjected to Mann-Whitney statistical analysis using SPSS software and false discovery rate correction. When the expression of the salivary proteins was compared between the T2DM patients with periodontitis with those who were periodontally healthy, seven proteins, including polymeric immunoglobulin receptor, plastin-2, actin related protein 3, leukocyte elastase inhibitor, carbonic anhydrases 6, immunoglobulin J and interleukin-1 receptor antagonist, were found to be differentially expressed (p < 0.01304). This implies that the proteins may have the potential to be used as biomarkers for the prediction of T2DM patients who may be prone to periodontitis. |