| Primary information |
|---|
| SALID | SAL_15203 |
| Biomarker name | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) |
| Biomarker Type | NA |
| Sampling Method | Age 39-82, Male and female |
| Collection Method | Unstimulated whole saliva sample |
| Analysis Method | Western Blot, In-Gel digestion, Mass spectrometry, Immunoprecipitation,Luminex Assay |
| Collection Site | Whole Saliva |
| Disease Category | Neurological Disorder |
| Disease/Condition | Parkinson's Disease |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | Downregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 21349902 |
| Year of Publication | 2011 |
| Biomarker ID | P37840 |
| Biomarker Category | Protein |
| Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Title of study | Salivary α-synuclein and DJ-1: potential biomarkers for Parkinson's disease |
| Abstract of study | NA |