| Primary information |
|---|
| SALID | SAL_14922 |
| Biomarker name | Protein S100-A8 (Calgranulin-A) (Calprotectin L1L subunit) (Cystic fibrosis antigen) (CFAG) (Leukocyte L1 complex light chain) (Migration inhibitory factor-related protein 8) (MRP-8) (p8) (S100 calciu |
| Biomarker Type | NA |
| Sampling Method | Age 35-66 |
| Collection Method | Participants were provided with a parafilm bolus to chew and provided 5ml of saliva by expectoration. Colected between 08:00 and 10:00 hours following overnight fasting. |
| Analysis Method | 2D SDS-PAGE + MALDI-TOF or (LC)-MS/MS |
| Collection Site | Whole Saliva |
| Disease Category | Dental Disorder |
| Disease/Condition | Periodontitis |
| Disease Subtype | Chronic periodontitis |
| Fold Change/ Concentration | 2.31 |
| Up/Downregulated | Upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 20149214 |
| Year of Publication | 2010 |
| Biomarker ID | P05109 |
| Biomarker Category | Protein |
| Sequence | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
| Title of study | Alterations in the salivary proteome associated with periodontitis |
| Abstract of study | AIM: To identify changes in the salivary proteome associated with active periodontitis.MATERIALS AND METHODS: Quantitative proteomics (two-dimensional sodium dodecyl sulphate polyacrylamide gel electrophoresis) was used to investigate whole saliva from individuals with severe periodontitis and their proteomic profiles before and after periodontal treatment were compared.RESULTS: A comparison of 128 proteins across all saliva samples identified 15 protein spots with altered abundance. The predominant alteration observed was an increase in the abundance of the S100 proteins S100A8/A9/A6. Of the remaining proteins with altered abundance, haptoglobin, prolactin inducible protein and parotid secretory protein have previously been associated with host defence.CONCLUSION: These results highlight the predominant involvement of S100 proteins in the host response during periodontitis, identify host defence components that have not been linked previously to this disease and suggest new potential biomarkers for monitoring disease activity in periodontitis. |