| Primary information |
|---|
| SALID | SAL_14730 |
| Biomarker name | Salivary acidic proline-rich phosphoprotein 1/2 |
| Biomarker Type | NA |
| Sampling Method | ASD age group: 4,65. TD group: 5, Inclusion criteria - DSMS IV criterions |
| Collection Method | Whole saliva was collected with small plastic aspirator at the basis of the tongue for less than 1 min and transferred to a plastic tube. |
| Analysis Method | RP-HPLC-ESI mass spectrometry, Data analysis (Bioworks Browser software provided with the Deca XP instrument or by MagTran 1.0 software.9 XIC strategy), Statistical Analysis (Pearson r was used to evaluate linear correlation between the separate peptides. Hotellings T-squared generalized means test was used for multivariate simultaneous comparison of peptide levels between the ASD group and healthy controls. The Student’s t test was applied to investigate differences between the separate |
| Collection Site | Whole Saliva |
| Disease Category | Developmental Disorder |
| Disease/Condition | Autism Spectrum Disorder |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 19367726 |
| Year of Publication | 2008 |
| Biomarker ID | P02810 |
| Biomarker Category | Protein |
| Sequence | MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ |
| Title of study | Hypo-phosphorylation of salivary peptidome as a clue to the molecular pathogenesis of autism spectrum disorders |
| Abstract of study | RP-HPLC-ESI-MS profile of naturally occurring salivary peptides of subjects with autistic spectrum disorder [ASD; N = 27:12 with diagnosis of autism, 1 with diagnosis of Asperger, 14 with diagnosis of pervasive developmental disorders not otherwise specified (PDD-NOS)] was compared to that of age-matched controls with the goal of identifying differences that could turn out to become hallmarks of at least a subgroup of ASD individuals. Phosphorylation level of four specific salivary phospho-peptides, namely statherin, histatin 1 (both, p < 0.0001) and acidic proline-rich proteins (both entire and truncated isoforms) (p < 0.005) was found significantly lower in autistic patients, with hypo-phosphorylation of at least one peptide observed in 18 ASD subjects (66%). Developmental scale assessment (Griffith or WISC-R) carried out on 14 ASD subjects highlighted a normal to borderline cognitive development in 10 of them, all included in the hypo-phosphorylated group. Phosphorylation of salivary peptides involves a Golgi casein kinase common to many organs and tissues, CNS included, whose expression seems to be synchronized during fetal development. Hypo-phosphorylation of salivary peptides suggests potential asynchronies in the phosphorylation of other secretory proteins, which could be relevant in CNS development either during embryonic development or in early infancy. These results suggest that analysis of salivary phospho-peptides might help to discriminate a considerable subgroup of ASD patients. |