Primary information |
---|
SALID | SAL_14660 |
Biomarker name | Interleukin-1 beta (IL-1 beta) (Catabolin) |
Biomarker Type | NA |
Sampling Method | Age 30-70, Male and female, A majority of the OSCC patients were diagnosed with early stage oral cancer. |
Collection Method | Unstimulated whole saliva samples were collected between 9 AM and 10 AM. Patients were asked to refrain from eating, drinking, smoking, and oral hygiene procedures for at least 1 h before saliva collection. |
Analysis Method | ELISA |
Collection Site | Whole Saliva |
Disease Category | Cancer |
Disease/Condition | Oral Cancer |
Disease Subtype | Mouth Neoplasms |
Fold Change/ Concentration | 3.00827498 |
Up/Downregulated | Upregulated |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 19193200 |
Year of Publication | 2008 |
Biomarker ID | P01584 |
Biomarker Category | Protein |
Sequence | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Title of study | Multiplexed immunobead-based assay for detection of oral cancer protein biomarkers in saliva |
Abstract of study | OBJECTIVE: For clinical applications of biomarkers, there is a need for multiplex assays using high throughput platforms. The objective of this study was to determine the efficacy of Luminex Multianalyte Profiling (xMAP) technology for measurement of salivary proteins and to evaluate whether multiplex assays are as effective as single-plex assays and enzyme-linked immunosorbent assay (ELISA).RESULTS: The average levels of interleukin-8 (IL-8) from the single-plex assay were 3313.2 +/- 3759.8 pg ml(-1) [oral squamous cell carcinoma (OSCC), n = 20] and 1061.7 +/- 1978.8 pg ml(-1) (control, n = 20). The IL-1beta average levels from the single-plex assay were 945.2 +/- 1134.8 pg ml(-1) (OSCC, n = 20) and 314.2 +/- 444.8 pg ml(-1) (control, n = 20). The average levels of IL-8 from the multiplex assay were 2834.9 +/- 3385.6 pg ml(-1) (OSCC, n = 20) and 947.3 +/- 2036.8 pg ml(-1) (control, n = 20). The IL-1beta average levels from the multiplex assay were 1013.5 +/- 1221.1 pg ml(-1) (OSCC, n = 20) and 376.3 +/- 576.3 pg ml(-1) (control, n = 20). The correlation coefficient between Luminex and ELISA assay for IL-8 (n = 19) and IL-1beta (n = 19) was 0.91 and 0.84, respectively.CONCLUSION: Luminex xMAP single-plex and multiplex assays are as effective as ELISA assays for quantification of proteins in saliva. Both IL-8 and IL-1beta were expressed at significantly higher levels in OSCC subjects than in the matched healthy control subjects. |