| Primary information |
|---|
| SALID | SAL_14217 |
| Biomarker name | IgG VH protein (Fragment) |
| Biomarker Type | NA |
| Sampling Method | NA |
| Collection Method | NA |
| Analysis Method | direct enzyme-linked immunosorbent assay |
| Collection Site | Whole Saliva |
| Disease Category | Metabolic Disorder |
| Disease/Condition | Diabetes Mellitus, Type 1 |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 18976260 |
| Year of Publication | 2009 |
| Biomarker ID | Q9Y298 |
| Biomarker Category | Protein |
| Sequence | MDWTWRILFLVAAATGTHAQVQLVQSGAEVKKPGASVKVSCKVSGYTLTELPVHWVGQAPGKGLEWVGSFDPESGESIYAREFQGSVTMTADTSTDIAYMELSSLRSDDTAVYYCAVPDPDAFDIWGQGTMVTVSSASTKGPSVFPLGSR |
| Title of study | Self-perceived oral health and salivary proteins in children with type 1 diabetes |
| Abstract of study | The aim was to validate self-perceived oral health with salivary IgG as an inflammatory parameter in children with type 1 diabetes. Unstimulated whole saliva samples were collected from 36 children with well controlled and 12 with poorly controlled type 1 diabetes and 40 non-diabetic children (Controls). Salivary flow rate, random blood glucose level, salivary protein concentration and immunoglobulin A and G levels were recorded using standard techniques. Data concerning oral health and diabetes status were collected. Self-perceived gingival bleeding (bleeding gums), bad breath and dry mouth were higher in diabetic children when compared with those in controls (P < 0.05). Gingival bleeding was frequently perceived by children with poorly controlled compared to well-controlled type 1 diabetes (P < 0.05) and controls (P < 0.001). Bad breath was common perceived by children with poorly controlled compared to well-controlled type 1 diabetes (P < 0.05) and controls (P < 0.0001). Salivary flow rate was lower in the diabetic children compared to controls (P < 0.01) with no difference between children with poorly controlled and well-controlled type 1 diabetes. Salivary IgG per mg protein concentration was higher in the diabetics when compared with the control group (P < 0.0001). IgG per mg protein levels were also higher in children with poorly controlled when compared with well-controlled type 1 diabetes (P < 0.05). There was no difference in IgA per mg protein and total protein concentrations between children with poorly controlled and well-controlled type 1 diabetes. Self-perceived gingival bleeding and salivary IgG per mg protein concentration were increased in children with type 1 diabetes compared with controls. These variables were also increased in children with poorly controlled compared with well-controlled type 1 diabetes. |