Detailed description page of SalivaDB
| This page displays user query in tabular form. |
SAL_12620 details |
| Primary information | |
|---|---|
| SALID | SAL_12620 |
| Biomarker name | Rho-related GTP-binding protein RhoQ (Ras-like protein TC10) (Ras-like protein family member 7A) |
| Biomarker Type | NA |
| Sampling Method | Adult |
| Collection Method | Unstimulated |
| Analysis Method | NA |
| Collection Site | Whole Saliva |
| Disease Category | Healthy |
| Disease/Condition | Healthy |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 15473691 |
| Year of Publication | 2004 |
| Biomarker ID | P17081 |
| Biomarker Category | Protein |
| Sequence | MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT |
| Title of study | Two-dimensional liquid chromatography study of the human whole saliva proteome |
| Abstract of study | The human whole saliva proteome was investigated using two-dimensional liquid chromatography (2-DLC). The 2-DLC study was able to identify, with high confidence, 102 proteins including most known salivary proteins (35), and a large number of common serum proteins (67). Peptides from proline-rich proteins, abundant in saliva, had unusual cleavage sites and were frequently only partially tryptic. Three proteins not previously observed in human saliva were also detected. Significantly greater numbers of identified proteins, including high molecular weight, low molecular weight, and proline-rich proteins, were found with 2-DLC compared to previously reported two-dimensional gel electrophoresis studies. |