| Primary information |
|---|
| SALID | SAL_12492 |
| Biomarker name | Calmodulin-like protein 5 |
| Biomarker Type | Diagnostic |
| Sampling Method | Unstimulated saliva samples were collected from 39 patients with OC and from 31 HCs. |
| Collection Method | Approximately 3 ml unstimulated whole saliva was collected over 5-10 min. |
| Analysis Method | LC-MS/MS analysis |
| Collection Site | Whole Saliva |
| Disease Category | Cancer |
| Disease/Condition | Oral Cancer |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 33402507 |
| Year of Publication | 2021 |
| Biomarker ID | Q9NZT1 |
| Biomarker Category | Protein |
| Sequence | MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE |
| Title of study | Identification of Salivary Proteomic Biomarkers for Oral Cancer Screening |
| Abstract of study | BACKGROUND/AIM: The current study aimed to identify biomarkers for differentiating between patients with oral cancer (OC) and healthy controls (HCs) on the basis of the comprehensive proteomic analyses of saliva samples by using liquid chromatography-mass spectrometry (LC-MS/MS).PATIENTS AND METHODS: Unstimulated saliva samples were collected from 39 patients with OC and from 31 HCs. Proteins in the saliva were comprehensively analyzed using LC-MS/MS. To differentiate between patients with OC and HCs, a multiple logistic regression model was developed for evaluating the discriminatory ability of a combination of multiple markers.RESULTS: A total of 23 proteins were significantly differentially expressed between the patients with OC and the HCs. Six out of the 23 proteins, namely α-2-macroglobulin-like protein 1, cornulin, hemoglobin subunit β, Ig k chain V-II region Vk167, kininogen-1 and transmembrane protease serine 11D, were selected using the forward-selection method and applied to the multiple logistic regression model. The area under the curve for discriminating between patients with OC and HCs was 0.957 when the combination of the six metabolites was used (95% confidence interval=0.915-0.998; p<0.001). Furthermore, these candidate proteins did not show a stage-specific difference.CONCLUSION: The results of the current study showed that six salivary proteins are potential non-invasive biomarkers for OC screening. |