Primary information |
---|
SALID | SAL_12199 |
Biomarker name | Ig heavy chain variable region |
Biomarker Type | NA |
Sampling Method | All saliva samples used in this experiment were provided by The First Affiliated Hospital of Wenzhou Medical University and approved by the ethics committee. |
Collection Method | Freshly collected saliva (5 mL) were centrifuged at 12,000g (Rotor FA-45-24-11, Centrifuge 5424 R, Eppendorf AG, Hamburg, Germany) for 30 min at 4 degreeC to remove cell debris and microvesicles. |
Analysis Method | Western blot + LC-MS/MS |
Collection Site | Saliva |
Disease Category | Healthy |
Disease/Condition | Healthy |
Disease Subtype | NA |
Fold Change/ Concentration | NA |
Up/Downregulated | NA |
Exosomal | Exosomal |
Organism | Homo sapiens |
PMID | 33159572 |
Year of Publication | 2021 |
Biomarker ID | Q0ZCI8 |
Biomarker Category | Protein |
Sequence | LVQLVESGGGVVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDPPYDSSGYYPTFDYWGQGTLVTVSS |
Title of study | Deep dive on the proteome of salivary extracellular vesicles: comparison between ultracentrifugation and polymer-based precipitation isolation |
Abstract of study | Salivary extracellular vesicles (EVs), as novel functional carriers and potential biomarkers, are usually obtained by ultracentrifugation (UC) and polyethylene glycol (PEG)-based precipitation methods. However, salivary EVs obtained by these two methods have not been systematically compared. Here, we perform an in-depth analysis on EVs isolated by these two methods using proteomics. Both methods obtain EVs ranging from 40 to 210 nm, with the PEG method resulting in a wider size distribution. PEG-separated products were irregularly shaped and aggregated, while UC-separated ones were monodispersed and teacup-shaped. Additionally, the expression of EV-specific markers was higher in UC-separated EVs. Using tandem mass spectrometry proteomics, we identified and quantified 1217 kinds of saliva exosomal proteins and 361 kinds of differential proteins, showing that UC can isolate more EV-related proteins. These results offer some guidance for EV separating and provide potential direction for the use of EVs in non-invasive diagnosis. |