Primary information |
---|
SALID | SAL_12011 |
Biomarker name | Reticulocalbin 1 |
Biomarker Type | Diagnostic |
Sampling Method | This study included 41 OSCC patients and 10 healthy volunteers (HV) who visited the Oral and Maxillofacial Surgery Department at the Aichi-Gakuin University Dental Hospital and Japanese Red Cross Nagoya Daiichi Hospital from December 2015 to March 2019. |
Collection Method | Via the spitting technique, subjects were asked to collect 2 ml of their saliva in a tube within 15 min |
Analysis Method | qRT-PCR |
Collection Site | Saliva |
Disease Category | Cancer |
Disease/Condition | Oral Cancer |
Disease Subtype | Oral cavity squamous cell carcinoma (OSCC) |
Fold Change/ Concentration | >2 |
Up/Downregulated | Upregulated |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 32871760 |
Year of Publication | 2020 |
Biomarker ID | Q15293 |
Biomarker Category | Protein |
Sequence | MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL |
Title of study | Salivary NUS1 and RCN1 Levels as Biomarkers for Oral Squamous Cell Carcinoma Diagnosis |
Abstract of study | AIM: Oral cancer may become advanced because of delay in diagnosis. In order to promote oral cancer screening, simple and highly reliable screening methods that can be implemented at general dental clinics are required. Herein we investigated differential salivary gene expression between oral squamous cell carcinoma (OSCC) patients and healthy volunteers (HV) to identify new biomarkers for OSCC detection.MATERIALS AND METHODS: Candidate genes were selected by microarrays, nuclear undecaprenyl pyrophosphate synthase 1 (NUS1) and reticulocalbin 1 (RCN1) were selected for further investigation. We used real-time quantitative reverse transcription PCR (qRT-PCR) to determine NUS1 and RCN1 expression levels in saliva and tissues.RESULTS: qRT-PCR analysis of clinical samples revealed that OSCC patients had significantly higher expression of salivary NUS1 and RCN1 than HV.CONCLUSION: A combination of NUS1 and RCN1 accurately distinguished patients from controls, and this combination can be implemented as a screening test for OSCC. |