| Primary information |
|---|
| SALID | SAL_12002 |
| Biomarker name | S100 calcium-binding protein A8 |
| Biomarker Type | Diagnostic/Prognostic |
| Sampling Method | Total 149 participants, 99 periodontitis and 50 healthy, were recruited. Among 99 non-surgical periodontitis treatment participants, 74 participants were revisited after three months. Periodontitis was classified as stage II-IV of new classification of periodontitis |
| Collection Method | Unstimulated whole saliva was collected using passive drool or spitting method for 10 min in a 50-ml conical tube in order to maintain consistency of samples. Collected saliva in tubes was centrifuged (2,600 x g for 15 min at 4degreeC), and supernatants were collected and stored at -80degreeC for further analysis. |
| Analysis Method | ELISA |
| Collection Site | Whole Saliva |
| Disease Category | Dental Disorder |
| Disease/Condition | Periodontitis |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | Upregulated |
| Exosomal | Non-exosomal |
| Organism | Homo sapiens |
| PMID | 32744384 |
| Year of Publication | 2020 |
| Biomarker ID | P05109 |
| Biomarker Category | Protein |
| Sequence | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
| Title of study | Diagnostic and Prognostic ability of salivary MMP-9 and S100A8 for periodontitis |
| Abstract of study | OBJECTIVES: Salivary diagnostic using matrix metalloproteinase (MMP) and S100 for periodontitis is a promising issue. However, its prognostic effect is still unclear. This study aimed to evaluate the prognostic ability of salivary MMP-9 and S100A8 for periodontitis through non-surgical periodontitis treatment clinical trial.MATERIALS AND METHODS: Total 149 participants, 99 periodontitis and 50 healthy, were recruited. Among 99 non-surgical periodontitis treatment participants, 74 participants were revisited after three months. Periodontitis was classified as stage II-IV of new classification of periodontitis proposed at 2018. Enzyme-linked immunosorbent assay kit was used to quantify salivary MMP-9 and S100A8. Receiver operating characteristic curve was applied for diagnostic ability. Paired t test was applied for prognostic ability evaluating changes in salivary markers between pre- and post-treatment.RESULTS: Salivary MMP-9 and S100A8 were associated with periodontitis (p < .05). The screening ability of algorithm using salivary MMP-9 and S100A8 for periodontitis was 0.86 (p < .05). After treatment, reduction rate of salivary S100A8 and MMP-9 was 83.7% and 23.5%, respectively, (p < .05): only salivary S100A8 was superior compared to clinical parameters.CONCLUSION: Algorithm using salivary MMP-9 and S100A8 showed high diagnostic power for periodontitis. Both salivary S100A8 and MMP-9 showed prognostic ability for periodontitis, but S100A8 was better. |