Detailed description page of SalivaDB
This page displays user query in tabular form. |
SAL_11991 details |
Primary information | |
---|---|
SALID | SAL_11991 |
Biomarker name | Metalloproteinase-9 |
Biomarker Type | Diagnostic |
Sampling Method | The pilot study included 10 women with obesity (BMI>30 kg/m2) and 6 women with normal body weight (control group). |
Collection Method | Saliva was collected using a standard method. Samples from the subjects were collected between 9:00 and 11:00 a.m. All subjects abstained from eating and drinking for 2 h. The sub- jects rinsed their mouths with deionized water and were sitting in a comfortable position with their eyes open and head titled slightly forward. Unstimulated whole saliva was collected for 10 min by spitting, described by Navazesh |
Analysis Method | ELISA |
Collection Site | Whole Saliva |
Disease Category | Metabolic Disorder |
Disease/Condition | Obesity |
Disease Subtype | NA |
Fold Change/ Concentration | NA |
Up/Downregulated | NA |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 32598403 |
Year of Publication | 2020 |
Biomarker ID | P14780 |
Biomarker Category | Protein |
Sequence | MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED |
Title of study | Which salivary components can differentiate metabolic obesity? |
Abstract of study | BACKGROUND: Obesity is a multifactorial disease and represents a global and relevant health problem. The aim of the study was to assess the concentration of pro-inflammatory cytokines (tumor necrosis factor-α (TNF-α), interleukin-8 (IL-8)) and other selected proteins as well as enzymes (soluble intercellular adhesion molecule 1 (sICAM1), calprotectin, matrix metalloproteinase-9 (MMP-9), matrix metalloproteinase-2 (MMP-2), toll like receptor 2 (TLR2)) detectable in the saliva of women who varied in body composition. It was debated whether there are marker factors in saliva that could indicate metabolic obesity.METHODS AND FINDINGS: The pilot study included 10 women with obesity (BMI>30 kg/m2) and 6 women with normal body weight (control group). The levels of TNF-α, IL-8, sICAM1, calprotectin, MMP-9, MMP-2, and TLR2 were checked by using the ELISA technique. We proved that women with metabolic obesity had significantly increased concentrations of IL-8, calprotectin, and MMP-2 in comparison with healthy subjects. Significant positive correlations of BMI with TNF-α, IL-8, and MMP-2 were observed. Similarly, the content of fat (in kg and %) in the bodies of the women correlated positively with TNF-α, IL-8, and MMP-2. Whereas, the visceral adipose tissue (VAT) correlated positively only with TNF-α and MMP-2, similarly to VAT/SAT. The WHR (waist hip ratio) was also positively correlated with TNF-α and MMP-2. Interestingly, we found that the level of insulin positively correlated with TNF- α concentration, which additionally confirmed metabolic obesity.CONCLUSIONS: We found that positive correlations of body mass index were observed only with salivary concentrations of TNF-α, MMP-2, and IL-8. Thus, it is worth conducting a study among a larger number of people taking into account these three salivary components. |