| Primary information |
|---|
| SALID | SAL_11983 |
| Biomarker name | Obestatin |
| Biomarker Type | NA |
| Sampling Method | This case-control study included 30 women with breast cancer as a case group and 30 healthy women as a matched control group. |
| Collection Method | Generally, the time of spe-cimen collection was 5 minutes; each participant donated 5 to 10 mL of unstimulated saliva. |
| Analysis Method | ELISA |
| Collection Site | Saliva |
| Disease Category | Cancer |
| Disease/Condition | Breast Cancer |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | Upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 32537654 |
| Year of Publication | 2020 |
| Biomarker ID | Q9UBU3 |
| Biomarker Category | Protein |
| Sequence | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK |
| Title of study | Serum and Saliva Levels of Cancer Antigen 15-3, Carcinoembryonic Antigen, Estradiol, Vaspin, and Obestatin as Biomarkers for the Diagnosis of Breast Cancer in Postmenopausal Women |
| Abstract of study | OBJECTIVE: To find suitable biomarkers for diagnosis of Breast cancer in serum and saliva; also, to examine the correlation between salivary and serum concentrations of suitable biomarkers.METHODS: This case-control study included 30 women with breast cancer as a case group and 30 healthy women as a matched control group. Blood and saliva specimens were collected from all participants. We evaluated serum and salivary cancer antigen 15-3 (CA15-3), carcinoembryonic antigen (CEA), estradiol, vaspin, and obestatin concentrations. Mann-Whitney U testing and Spearman correlation coefficients were used for statistical analysis.RESULTS: Serum and salivary concentrations of estradiol were significantly higher in patients with breast cancer (BC) than in healthy women (P < .05). Also, serum CEA and salivary obestatin concentrations were significantly higher in BC patients than in the control group (P < .05). However, there was no significant difference between other parameters in patients with BC and controls. We observed a positive correlation between serum and salivary concentrations of CA15-3, as well as a negative correlation between serum and salivary concentrations of vaspin and obestatin.CONCLUSION: The results of this study demonstrated that concentrations of CEA and estradiol in serum, obestatin in serum and saliva, and estradiol in saliva were significantly different between the 2 groups. |