| Primary information |
|---|
| SALID | SAL_11979 |
| Biomarker name | Soluble CD14 |
| Biomarker Type | NA |
| Sampling Method | In a non-randomized fashion, individuals reporting to the Indiana University School of Dentistry between the age ranges of 6-15 years (children), 20-29 years (young adults), 30-49 years (adults), and > 50 years (older adults) were recruited |
| Collection Method | At least 2 ml of unstimulated whole saliva (UWS) was col- lected by passively drooling into a chilled centrifuge tube for 5 min |
| Analysis Method | ELISA |
| Collection Site | Whole Saliva |
| Disease Category | Dental Disorder |
| Disease/Condition | Chronic Periodontitis |
| Disease Subtype | NA |
| Fold Change/ Concentration | 2 |
| Up/Downregulated | Upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 32529494 |
| Year of Publication | 2020 |
| Biomarker ID | P08571 |
| Biomarker Category | Protein |
| Sequence | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA |
| Title of study | Changes in salivary microbial sensing proteins CD14 and TLR2 with aging |
| Abstract of study | OBJECTIVE: Soluble toll-like receptor-2 (sTLR2) and soluble CD14 (sCD14) in saliva are defense proteins that bind specific microbe-associated molecular patterns. Since the oral flora changes with aging, the objective of this study is to determine and compare the concentration of sTLR2 and sCD14 in the saliva of healthy individuals in age groups from the first to the sixth decade of life.METHODS: Unstimulated whole saliva was collected after obtaining informed consent. The concentration of sCD14 and sTLR-2 was measured by enzyme-linked immunosorbent assay. Statistical differences between the age groups were determined by analysis of variance. The relationship between the two markers in each age group was evaluated by Pearson's correlation coefficient and linear regression analyses.RESULTS: The concentration of salivary sTLR2 was highest in the youngest, and that of the sCD14 was highest in the oldest age group. While the salivary sCD14 and the sTLR2 exhibited a moderate negative correlation in the youngest, the relationship between the two markers was inversed in the oldest age group.CONCLUSIONS AND CLINICAL RELEVANCE: The results of our exploratory study suggest a need to adjust for age-dependent changes in sCD14 and sTLR2 in healthy saliva while assessing the two proteins as biomarkers. |