| Primary information |
|---|
| SALID | SAL_11892 |
| Biomarker name | Fibroblast growth factor 19 |
| Biomarker Type | Diagnostic |
| Sampling Method | As healthy controls, 140 non-NSCLC people were included. In the validation phase, we followed a similar procedure to recruit 60 patients with NSCLC and 60 healthy controls |
| Collection Method | Totally 2 mL whole saliva was collected and placed on ice. |
| Analysis Method | qRT-PCR |
| Collection Site | Whole Saliva |
| Disease Category | Cancer |
| Disease/Condition | Lung Cancer |
| Disease Subtype | Non-small-cell lung cancer (NSCLC) |
| Fold Change/ Concentration | NA |
| Up/Downregulated | Upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 32080083 |
| Year of Publication | 2020 |
| Biomarker ID | O95750 |
| Biomarker Category | Protein |
| Sequence | MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Title of study | Combined use of circulating tumor cells and salivary mRNA to detect non-small-cell lung cancer |
| Abstract of study | Liquid biopsy is an emerging technique for noninvasive detection of various cancers. Majority of liquid biopsy tests still, however, use solitary type of biomarkers with unsatisfactory sensitivity and specificity. To this end, a combined approach of circulating tumor cells (CTCs) and salivary mRNA biomarkers was evaluated for discriminating non-small-cell lung cancer (NSCLC) from healthy controls.Our study included a discovery phase to find multiple biomarkers, and an independent validation phase to confirm the applicability of the selected biomarkers. In the discovery phase, CTC level in blood and 5 mRNA biomarkers in saliva (i.e., CCNI, Epidermal growth factor receptor [EGFR], FGF19, FRS2, and GREB1) were measured for 140 NSCLC patients and 140 healthy controls, followed by developing a predictive model. Next, this panel of biomarkers was applied to another patient cohort consisted of 60 patients with NSCLC and 60 healthy controls in the validation phase.We found that our novel biomarker panel could differentiate patients with NSCLC from healthy controls with high sensitivity (92.1%) and high specificity (92.9%) in the discovery phase. In the validation phase, we achieved sensitivity of 88.3% and specificity of 90.0%.To our best knowledge, it is the first time that a combined use of CTC and salivary mRNA biomarkers were applied for noninvasive detection of NSCLC. |