| Primary information |
|---|
| SALID | SAL_11857 |
| Biomarker name | Acidic proline-rich proteins |
| Biomarker Type | NA |
| Sampling Method | Salivary protein profiles of patients (n = 23) and healthy controls (n = 30) were compared. |
| Collection Method | Collected from 0.5 to 0.8 mL of whole saliva depending on the individual disposition. |
| Analysis Method | HPLC-ESI-MS |
| Collection Site | Whole Saliva |
| Disease Category | Immune System Disorder |
| Disease/Condition | antibody deficiencies |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 31916122 |
| Year of Publication | 2020 |
| Biomarker ID | Q96NZ9 |
| Biomarker Category | Protein |
| Sequence | MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ |
| Title of study | RP-HPLC-ESI-IT Mass Spectrometry Reveals Significant Variations of the Human Salivary Protein Profile Associated with Predominantly Antibody Deficiencies |
| Abstract of study | PURPOSE: Present study is designed to discover potential salivary biomarkers associated with predominantly antibody deficiencies, which include a large spectrum of disorders sharing failure of antibody production, and B cell defects resulting in recurrent infections, autoimmune and inflammatory manifestations, and tumor susceptibility. Understanding and clinical classification of these syndromes is still challenging.METHODS: We carried out a study of human saliva based on liquid chromatography-mass spectrometry measurements of intact protein mass values. Salivary protein profiles of patients (n = 23) and healthy controls (n = 30) were compared.RESULTS: Patients exhibited lower abundance of α-defensins 1-4, cystatins S1 and S2, and higher abundance of glutathionylated cystatin B and cystatin SN than controls. Patients could be clustered in two groups on the basis of different levels of cystatin SN, S1 and S2, suggesting that these proteins may play different roles in the disease.CONCLUSIONS: Quantitative variations of these pro-inflammatory and antimicrobial peptides/proteins may be related to immunodeficiency and infectious condition of the patients. The high incidence of tumors in the group with the highest level of cystatin SN, which is recognized as tumoral marker, appeared an intriguing result deserving of future investigations. Data are available via ProteomeXchange with identifier PXD012688. |