| Primary information |
|---|
| SALID | SAL_11703 |
| Biomarker name | Salivary acidic proline-rich phosphoprotein 1/2 |
| Biomarker Type | NA |
| Sampling Method | This is a case-control study with men older than 18 years of age, matched by age. |
| Collection Method | Unstimulated whole saliva was collected centrifuged 3000g for 15 min at 4 degreeC. |
| Analysis Method | MS |
| Collection Site | Supernatant Saliva |
| Disease Category | Other |
| Disease/Condition | Alcohol and Tobacco Dependent |
| Disease Subtype | NA |
| Fold Change/ Concentration | <10 |
| Up/Downregulated | Downregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 31494441 |
| Year of Publication | 2019 |
| Biomarker ID | P02810 |
| Biomarker Category | Protein |
| Sequence | MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ |
| Title of study | Salivary proteome characterization of alcohol and tobacco dependents |
| Abstract of study | BACKGROUND: Alcohol and substances found in tobacco may alter salivary flow and amount of saliva proteins. This study aimed to compare salivary proteins between alcohol dependent smokers and controls.METHODS: This is a case-control study with men older than 18 years of age, matched by age. The alcohol-dependent group was composed by heavy smokers and alcohol consumers. Unstimulated whole saliva was collected from all subjects. Analysis of digested peptides was performed in mass spectrometer. Data were processed using ProteinLynx GlobalServer software. Results were obtained by searching theHomo sapiens database from the UniProt catalog. The search tool IBI-IMIM was used to identify candidate proteins for biomarkers.RESULTS: Alcohol-dependent and control groups were composed of nine participants each, with mean age of 36.89 ± 2.57 and 35.78 ± 1.64 years, respectively. 404 salivary proteins were found in both groups; 282 in the alcohol-dependent. Among the 96 proteins presented in both groups, 32 were up-regulated in the alcohol dependents (i.e. "Hemoglobin subunit beta" and "Forkhead box protein P2" were up-regulated at least 10-fold), 23 were down-regulated (i.e. "Statherin" and "RNA-binding protein 25" were down-regulated at least 10-fold), and 41 presented similar expression in both groups. 71 proteins were candidates for biomarkers of disorders 58 presented in alcohol dependents' saliva. The most common disorders were neoplasms, genetic, cardiovascular, metabolic and glandular diseases.CONCLUSIONS: Salivary protein profile undergoes strong changes in alcohol and tobacco dependents. 34% of salivary proteins present in alcohol and tobacco dependents were present in controls; 14.5% of them were expressed in similar quantity. |