| Primary information |
|---|
| SALID | SAL_11228 |
| Biomarker name | Protein XRP2 |
| Biomarker Type | NA |
| Sampling Method | Saliva samples from 15 hepatocellular carcinoma patients and 15 healthy controls |
| Collection Method | Unstimulated whole saliva samples were collected. |
| Analysis Method | iTRAQ + ELISA |
| Collection Site | Whole Saliva |
| Disease Category | Cancer |
| Disease/Condition | Liver Cancer |
| Disease Subtype | Hepatocellular carcinoma |
| Fold Change/ Concentration | <0.67 |
| Up/Downregulated | Downregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 31041878 |
| Year of Publication | 2019 |
| Biomarker ID | O75695 |
| Biomarker Category | Protein |
| Sequence | MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI |
| Title of study | iTRAQ-based proteomics reveals SOD2 as a potential salivary biomarker in liver cancer |
| Abstract of study | BACKGROUND: Salivary proteomic analysis has been extensively used in a wide range of cancer, but not in hepatocellular carcinoma. The aim of this study was to identify potential salivary biomarkers for hepatocellular carcinoma clinical screening.METHODS: In this study, we performed isobaric tags for relative and absolute quantitation (iTRAQ)-based quantitative proteomics analysis to detect differentially expressed proteins between saliva samples from 15 hepatocellular carcinoma patients and 15 healthy controls. Enzyme-linked immunosorbent assay (ELISA) verification was undertaken in saliva samples from 14 hepatocellular carcinoma patients and 14 healthy controls.RESULTS: Overall, 133 proteins with significant differential expression level (ratio > 1.5 or < 0.67) were detected. Using bioinformatic analysis, two candidate proteins were selected and subsequently verified by ELISA. The increased expression of superoxide dismutase 2, mitochondrial (SOD2) in hepatocellular carcinoma patients was confirmed by ELISA, with an area under the curve value of 0.9082.CONCLUSIONS: iTRAQ-based quantitative proteomics revealed that SOD2 might serve as a potential salivary biomarker for hepatocellular carcinoma detection. Our results indicated that a noninvasive and inexpensive salivary test might be established for hepatocellular carcinoma detection. |