| Primary information |
|---|
| SALID | SAL_11121 |
| Biomarker name | Salivary alpha-amylase |
| Biomarker Type | NA |
| Sampling Method | Healthy adults (N = 75; 33 Type D; aged 18-42; 64% female) |
| Collection Method | Participants were instructed to allow saliva to pool in the bottom of their mouth, and then pass the saliva through a SalivaBio Collection Aid (SCA) into a 4 ml polypropylene tube for 2min. |
| Analysis Method | kinetic enzyme assay |
| Collection Site | Saliva |
| Disease Category | Stress |
| Disease/Condition | Acute stress in Type D personality |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 30856045 |
| Year of Publication | 2019 |
| Biomarker ID | P04746 |
| Biomarker Category | Protein |
| Sequence | MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
| Title of study | An experimental investigation into cardiovascular, haemodynamic and salivary alpha amylase reactivity to acute stress in Type D individuals |
| Abstract of study | Type D personality is characterized by increased social inhibition and negative affectivity. Research demonstrates associations between Type D and poor physical health. Maladaptive sympathetic arousal is suggested as a potential mechanism, however, findings are inconsistent and studies mainly focus on basic cardiovascular parameters. The current study examines cardiovascular and haemodynamic parameters in addition to salivary alpha amylase (sAA) as markers of sympathetic stress reactivity in Type D individuals. Healthy adults (N = 75; 33 Type D; aged 18-42; 64% female) completed a multitasking stressor while continuous beat-to-beat cardiovascular function was measured. Saliva samples were obtained at baseline, pre-task, post-task, +10 min and +20 min post-task. Type Ds exhibited dysfunctional cardiovascular reactivity, characterized by blunted total peripheral resistance, slower stroke volume recovery and potentially unhealthy changes in haemodynamic profile. Alpha amylase reactivity was evident, but group differences were not significant. Findings indicate dysregulated sympathetic reactivity in Type D individuals, exemplified by a maladaptive haemodynamic profile. |