| Primary information |
|---|
| SALID | SAL_11091 |
| Biomarker name | Alpha-synuclein |
| Biomarker Type | Diagnostic |
| Sampling Method | About 100 PD patients, 20 patients affected by PSP and 80 age- and sex-matched healthy subjects. |
| Collection Method | A minimum quantity of 1 ml of saliva from each subject. Saliva was collected by drool into a 50 ml vial, which was immediately placed on ice in order to block proteolytic activity. |
| Analysis Method | ELISA |
| Collection Site | Saliva |
| Disease Category | Neurological Disorder |
| Disease/Condition | Parkinson's Disease |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 30796010 |
| Year of Publication | 2019 |
| Biomarker ID | P37840 |
| Biomarker Category | Protein |
| Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Title of study | Salivary alpha-synuclein in the diagnosis of Parkinson's disease and Progressive Supranuclear Palsy |
| Abstract of study | INTRODUCTION: Alpha-synuclein (α-syn) aggregation is the pathological hallmark of Parkinson's Disease (PD). In this study, we measured α-syn total (α-syntotal), oligomeric α-syn (α-synolig) and α-synolig/α-syntotal ratio in the saliva of patients affected by PD and in age and sex-matched healthy subjects. We also compared salivary α-syntotal measured in PD with those detected in Progressive Supranuclear Palsy (PSP), in order to assess whether salivary α-syn can be used as a biomarker for PD and for the differential diagnosis between PD and PSP.METHODS: We studied 100 PD patients, 20 patients affected by PSP and 80 age- and sex-matched healthy subjects. ELISA analysis was performed using two commercial ELISA platforms and a specific ELISA assay for α-syn aggregates.RESULTS: We detected lower α-syntotal and higher α-synolig in PD than in healthy subjects. Conversely in PSP salivary α-syntotal concentration was comparable to that measured in healthy subjects. Receiver Operating Characteristic analyses revealed specific cut-off values able to differentiate PD patients from healthy subjects and PSP patients with high sensitivity and specificity. However, there was no significant correlation between clinical and molecular data.CONCLUSION: Salivary α-syn detection could be a promising and easily accessible biomarker for PD and for the differential diagnosis between PD and PSP. |