| Primary information |
|---|
| SALID | SAL_10281 |
| Biomarker name | Salivary adiponectin |
| Biomarker Type | Diagnostic |
| Sampling Method | Salivary adiponectin and ADA were measured in patients with SS (n = 17) and compared to their values in healthy controls (n = 13) and patients suffering from drug-induced xerostomia (non-SS sicca group; n = 19). |
| Collection Method | Unstimulated whole saliva was collected by drooling before the oral examination. |
| Analysis Method | ELISA |
| Collection Site | Whole Saliva |
| Disease Category | Autoimmune Disorder |
| Disease/Condition | Sjogren's Syndrome |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | upregulated |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 30030617 |
| Year of Publication | 2018 |
| Biomarker ID | Q15848 |
| Biomarker Category | Protein |
| Sequence | MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
| Title of study | Salivary adiponectin, but not adenosine deaminase, correlates with clinical signs in women with Sjögren's syndrome: a pilot study |
| Abstract of study | OBJECTIVES: To evaluate salivary adiponectin and adenosine deaminase (ADA) in women suffering from Sjögren's syndrome (SS).METHODS: Salivary adiponectin and ADA were measured in patients with SS (n = 17) and compared to their values in healthy controls (n = 13) and patients suffering from drug-induced xerostomia (non-SS sicca group; n = 19). A clinical history was made for each patient, patients were examined clinically, and xerostomia inventory (XI) was performed.RESULTS: Salivary adiponectin corrected by total protein was higher in patients with SS than in healthy individuals (P < 0.05) or patients with non-SS sicca (P < 0.01) and correlated with XI (r = 0.555; P < 0.05). Salivary ADA was higher in patients with SS and non-SS sicca compared to controls (P < 0.05 in both cases).CONCLUSION: The results of the present study indicate that adiponectin and ADA are increased in the saliva of patients with SS.CLINICAL RELEVANCE: Salivary adiponectin corrected by total protein can be a potential biomarker of SS.TRIAL REGISTRATION: NCT03156569. |