Primary information |
---|
SALID | SAL_10271 |
Biomarker name | Human Growth Factor |
Biomarker Type | Diagnostic |
Sampling Method | Saliva samples collected from HNSCC patients (n = 58) compared to a control cohort (n = 8 smokers and n = 30 non-smokers). |
Collection Method | Saliva were expectorated directly into a 50 mL Falcon tube kept on ice and were transported from the hospital to the laboratory on dry ice. |
Analysis Method | The Bio-Plex Proª assay |
Collection Site | Saliva |
Disease Category | Cancer |
Disease/Condition | Head and neck Cancer |
Disease Subtype | Head and neck squamous cell carcinoma |
Fold Change/ Concentration | NA |
Up/Downregulated | Upregulated |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 30001714 |
Year of Publication | 2018 |
Biomarker ID | Q6QBS2 |
Biomarker Category | Protein |
Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Title of study | A pilot study to profile salivary angiogenic factors to detect head and neck cancers |
Abstract of study | BACKGROUND: Early diagnosis of head and neck squamous cell carcinoma (HNSCCs) is an appealing way to increase survival rates in these patients as well as to improve quality of life post-surgery. Angiogenesis is a hallmark of tumor initiation and progression. We have investigated a panel of angiogenic factors in saliva samples collected from HNSCC patients and controls using the Bio-Plex ProTM assays.METHODS: We have identified a panel of five angiogenic proteins (sEGFR, HGF, sHER2, sIL-6Ra and PECAM-1) to be elevated in the saliva samples collected from HNSCC patients (n = 58) compared to a control cohort (n = 8 smokers and n = 30 non-smokers).RESULTS: High positive correlations were observed between the following sets of salivary proteins; sEGFR:sHER2, sEGFR:HGF, sEGFR:sIL-6Rα, sHER2:HGF and sHER2:sIL6Ra. A moderate positive correlation was seen between FGF-basic and sEGFR.CONCLUSION: We have shown that angiogenic factor levels in saliva can be used as a potential diagnostic biomarker panel in HNSCC. |