Primary information |
---|
SALID | SAL_10218 |
Biomarker name | Beta-2-glycoprotein I (ApoH) |
Biomarker Type | NA |
Sampling Method | Ten Patients were diagnosed with CP, eleven with AP and twelve were healthy control. |
Collection Method | 3mL saliva was collected for 5 mins from each patients and healthy subjects. |
Analysis Method | LC-MRM |
Collection Site | Saliva |
Disease Category | Dental Disorder |
Disease/Condition | Periodontitis |
Disease Subtype | Chronic Periodontis |
Fold Change/ Concentration | NA |
Up/Downregulated | NA |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 29900194 |
Year of Publication | 2018 |
Biomarker ID | J3QRN2 |
Biomarker Category | Protein |
Sequence | MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMF |
Title of study | Data from a targeted proteomics approach to discover biomarkers in saliva for the clinical diagnosis of periodontitis |
Abstract of study | This study focused on the search for new biomarkers based on liquid chromatography-multiple reaction monitoring (LC-MRM) proteomics profiling of whole saliva from patients with periodontitis compared to healthy subjects. The LC-MRM profiling approach is a new and innovative method that has already been validated for the absolute and multiplexed quantification of biomarkers in several diseases. The dataset for this study was produced using LC-MRM to monitor protein levels in a multiplex assay, it provides clinical information on salivary biomarkers of periodontitis. The data presented here is an extension of our recently published research article (Mertens et al., 2017) [1]. |